Custrd is out on the App Store — Download it free →
Back to recipes

Sweet and Spicy Chicken Wings

Crispy baked chicken wings tossed in a sticky sweet and spicy sauce, finished with sesame seeds. Ready in about 30 minutes with minimal effort.

Total time
35 min
Servings
4
Calories
420
Protein
28g
Sweet and Spicy Chicken Wings
comfortingfestivekoreandairy-freechickencrispystickygame day

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat 2 lb chicken wings dry with paper towels and place on a baking sheet lined with foil. Bake for 25-30 minutes until golden and crispy, flipping halfway.

  2. Step 2

    In a small bowl, whisk together 3 tbsp gochujang, 2 tbsp honey, 2 tbsp soy sauce, and 1 tbsp sesame oil until smooth.

  3. Step 3

    Transfer the cooked wings to a large bowl. Pour the sauce over and toss until every wing is coated.

  4. Step 4

    Sprinkle with 1 tbsp sesame seeds and serve hot.

Tools you’ll need

  • baking sheet
  • aluminum foil
  • small bowl
  • large bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.