CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Lazy Girl Butter Parmesan Pasta

Four ingredients, one pot, 15 minutes. Buttery, garlicky, cheesy pasta that tastes like you actually tried — no cream needed, just pasta water magic.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Lazy Girl Butter Parmesan Pasta
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

  • 8 oz pasta (spaghetti or linguine)
  • 4 tbsp butter
  • 3 cloves garlic, minced
  • ½ cup parmesan, grated

Instructions

  1. 1

    Boil pasta in salted water until al dente, about 9 minutes.

  2. 2

    Reserve 1 cup pasta water before draining.

  3. 3

    Melt butter over medium heat, add garlic, cook 30 seconds until fragrant.

  4. 4

    Add hot pasta to the pan with 0.5 cup pasta water and toss.

  5. 5

    Remove from heat, stir in parmesan until creamy, add more pasta water if needed.

  6. 6

    Season with salt and pepper, serve immediately.

Tools you’ll need

  • large pot
  • colander
  • small skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.