Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lazy Girl Butter Parmesan Pasta

Four ingredients, one pot, 15 minutes. Buttery, garlicky, cheesy pasta that tastes like you actually tried — no cream needed, just pasta water magic.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Lazy Girl Butter Parmesan Pasta
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 9 minutes.

  2. Step 2

    Reserve 1 cup pasta water before draining.

  3. Step 3

    Melt butter over medium heat, add garlic, cook 30 seconds until fragrant.

  4. Step 4

    Add hot pasta to the pan with 0.5 cup pasta water and toss.

  5. Step 5

    Remove from heat, stir in parmesan until creamy, add more pasta water if needed.

  6. Step 6

    Season with salt and pepper, serve immediately.

Tools you’ll need

  • large pot
  • colander
  • small skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.