Lazy Girl Butter Parmesan Pasta
Four ingredients, one pot, 15 minutes. Buttery, garlicky, cheesy pasta that tastes like you actually tried — no cream needed, just pasta water magic.
- Total time
- 15 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g

comfortsimpleitalianvegetariancreamytenderweeknightpasta
Ingredients
- 8 oz pasta (spaghetti or linguine)
- 4 tbsp butter
- 3 cloves garlic, minced
- ½ cup parmesan, grated
Instructions
- 1
Boil pasta in salted water until al dente, about 9 minutes.
- 2
Reserve 1 cup pasta water before draining.
- 3
Melt butter over medium heat, add garlic, cook 30 seconds until fragrant.
- 4
Add hot pasta to the pan with 0.5 cup pasta water and toss.
- 5
Remove from heat, stir in parmesan until creamy, add more pasta water if needed.
- 6
Season with salt and pepper, serve immediately.
Tools you’ll need
- large pot
- colander
- small skillet
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



