Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Minute Lemon Curd Tart with Torched Meringue

No-bake lemon curd in a buttery crust topped with silky meringue and a chocolate dome — torched golden and viral-ready. Looks restaurant-fancy, tastes bright and tangy.

Total time
25 min
Servings
6
Calories
420
Protein
4g
25-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix graham cracker crumbs with melted butter, press into a 9-inch tart pan, and refrigerate.

  2. Step 2

    Whip heavy cream to soft peaks, then fold into lemon curd until combined and mousse-like.

  3. Step 3

    Spread lemon curd mousse over the chilled crust, smooth the top, and chill while you make meringue.

  4. Step 4

    Beat egg whites with an electric mixer until soft peaks form, about 2 minutes.

  5. Step 5

    Gradually add sugar while beating until stiff, glossy peaks form and sugar dissolves, ~3 minutes.

  6. Step 6

    Spread meringue over the lemon curd, creating peaks and swirls with the back of a spoon.

  7. Step 7

    Melt chocolate in a heatproof bowl over hot water until glossy, then drizzle or pour over meringue.

  8. Step 8

    Use a kitchen torch to lightly brown the meringue peaks until golden. Serve chilled or at room temperature.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • electric mixer or whisk
  • heatproof bowl
  • kitchen torch
  • rubber spatula
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.