CookSnap is in beta — Get it free on TestFlight →
Back to recipes

30-Min Lemon Curd Tart with Torched Meringue

Crispy store-bought tart shell filled with silky lemon curd, topped with torched Italian meringue that's glossy and caramelized. Showstopper dessert in under 30 minutes, no classical pastry skills needed.

Total time
30 min
Servings
4
Calories
285
Protein
3g
30-Min Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispycreamyfluffyDessert

Ingredients

  • 1 shell store-bought pre-baked tart shell (9-inch)
  • 1 jar (10 oz) store-bought lemon curd
  • ½ cup granulated sugar
  • 3 large egg whites
  • ¼ tsp cream of tartar
  • ½ tsp vanilla extract
  • 3 tbsp water
  • 1 tsp lemon zest

Instructions

  1. 1

    Spread lemon curd evenly into the pre-baked tart shell, filling to about 1/4 inch from the top.

  2. 2

    In a heatproof bowl, whisk egg whites, cream of tartar, and sugar together over simmering water, stirring constantly, until sugar dissolves and mixture reaches 160°F (71°C), ~7 minutes.

  3. 3

    Remove from heat and whip with an electric mixer on high until stiff, glossy peaks form, ~4 minutes.

  4. 4

    Fold in vanilla extract and lemon zest gently with a rubber spatula until just combined.

  5. 5

    Spoon or pipe meringue onto the lemon curd, creating peaks and swirls across the surface.

  6. 6

    Hold a kitchen torch 2 inches from the meringue and rotate the tart slowly, torching until peaks are golden brown and caramelized, ~2 minutes.

  7. 7

    Let cool for 2 minutes before slicing and serving.

Tools you’ll need

  • 9-inch pre-baked tart shell
  • heatproof mixing bowl
  • saucepan (for water bath)
  • candy/instant-read thermometer
  • electric mixer (handheld or stand)
  • rubber spatula
  • kitchen torch
  • piping bag with large round tip (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.