Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Lemon Curd Tartlets with Torched Meringue

No-bake lemon tarts with glossy store-bought curd, homemade meringue peaks torched golden, and candied lime slices. Looks fancy, tastes restaurant-level, ready in minutes.

Total time
15 min
Servings
4
Calories
285
Protein
4g
15-Min Lemon Curd Tartlets with Torched Meringue
elegantfancylightfrenchvegetariancreamycrispyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spoon lemon curd into each tartlet shell, dividing evenly. Set aside.

  2. Step 2

    Add egg whites and cream of tartar to a clean bowl. Whip until soft peaks form, ~3 minutes.

  3. Step 3

    Gradually add sugar while whipping until stiff, glossy peaks form, another ~2 minutes.

  4. Step 4

    Pipe or dollop meringue onto each tart, creating peaks and swirls.

  5. Step 5

    Use a kitchen torch to brown the meringue peaks until golden with light char, 10-15 seconds per tart.

  6. Step 6

    Thinly slice limes and arrange on the plate alongside the tarts. Serve immediately.

Tools you’ll need

  • 4 pre-baked tartlet shells (3-inch)
  • medium mixing bowl
  • electric mixer or whisk
  • kitchen torch
  • piping bag (optional)
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.