Custrd is out on the App Store — Download it free →
Back to recipes

Madura Chicken Satay

Juicy grilled chicken skewers with a rich, creamy peanut sauce, served with fresh cucumber, red onion, and tomato. A simple weeknight version of the Indonesian classic.

Total time
35 min
Servings
4
Calories
480
Protein
38g
Madura Chicken Satay
comfortingexoticindonesiangluten-freechickentendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the 1.5 lb chicken breast into 1-inch strips and thread onto skewers. In a bowl, mix 2 tbsp soy sauce, 1 tbsp brown sugar, and juice of half the lime. Brush over the chicken and let sit for 10 minutes.

  2. Step 2

    While the chicken marinates, make the sauce: in a small saucepan over medium heat, combine 1 cup coconut milk, 1/2 cup peanut butter, 1 tbsp soy sauce, 1 tbsp brown sugar, and juice of the remaining lime half. Stir until smooth and bubbling, about 5 minutes. Add water if too thick.

  3. Step 3

    Heat a grill or grill pan over medium-high. Cook the skewers for 4-5 minutes per side, until charred at the edges and cooked through (no pink inside).

  4. Step 4

    Slice the cucumber and red onion into thin rounds. Arrange on a plate with the cooked skewers.

  5. Step 5

    Serve the skewers with the warm peanut sauce drizzled over or on the side. Garnish with cilantro or extra lime if you have them.

Tools you’ll need

  • skewers
  • grill or grill pan
  • small saucepan
  • brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.