Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Malaysian Roti Canai with Curry Dip

Crispy, flaky fried flatbread with a laminated dough, served with spiced curry dipping sauce. A showstopping vegetarian breakfast that looks harder than it is.

Total time
35 min
Servings
2
Calories
580
Protein
9g
Malaysian Roti Canai with Curry Dip
indulgentcomfortmalaysianvegetarianvegetariancrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Add warm water slowly, stirring until shaggy dough forms.

  2. Step 2

    Knead dough 5–8 minutes on a floured surface until smooth and elastic.

  3. Step 3

    Divide dough into 4 equal balls. Brush each with ghee, cover, and rest 10 minutes.

  4. Step 4

    Heat 1 tbsp ghee in a small pan. Sauté onion 2–3 minutes until softened.

  5. Step 5

    Stir in curry powder and cook 30 seconds until fragrant, then add coconut milk.

  6. Step 6

    Simmer 4–5 minutes until thickened slightly. Finish with lime juice. Keep warm.

  7. Step 7

    Stretch one dough ball into a thin 8–10 inch circle on a lightly oiled surface.

  8. Step 8

    Heat 1 tbsp ghee in a 10-inch skillet over medium-high until shimmering, ~60 seconds.

  9. Step 9

    Slide roti into hot skillet. Cook 2–3 minutes until golden and crispy on bottom.

  10. Step 10

    Flip and cook another 1–2 minutes until bottom is spotted and crispy.

  11. Step 11

    Transfer to a plate. Repeat with remaining dough balls and ghee.

  12. Step 12

    Fold warm roti into triangles or roll loosely. Serve immediately with curry dip.

Tools you’ll need

  • mixing bowl
  • measuring cups and spoons
  • floured surface or cutting board
  • 10-inch non-stick or cast iron skillet
  • small saucepan
  • wooden spoon
  • whisk
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.