Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Roti Canai with Curry Dip

Flaky Malaysian flatbread made with a simple dough, stretched thin, and pan-fried until golden and crispy. Serve with spiced curry sauce for dipping—a street-food breakfast that feels fancy but takes under 30 minutes.

Total time
35 min
Servings
2
Calories
480
Protein
8g
Roti Canai with Curry Dip
indulgentrusticmalaysianvegetarianvegetariancrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Add 0.5 cup water gradually, stirring until a shaggy dough forms.

  2. Step 2

    Knead for 3 minutes until the dough becomes smooth and slightly sticky. Add water 1 tbsp at a time if dry.

  3. Step 3

    Cover with a damp cloth and rest for 15 minutes. This makes stretching much easier.

  4. Step 4

    Heat 1 tbsp of the melted butter in a small skillet over medium heat. Add minced garlic and onion.

  5. Step 5

    Cook, stirring, until fragrant and the onion softens, about 2 minutes. Stir in curry powder.

  6. Step 6

    Add coconut milk and simmer for 3 minutes, stirring occasionally, until thickened and fragrant.

  7. Step 7

    Divide dough into 2 equal portions. On an oiled work surface, stretch one piece into a thin 8-inch round.

  8. Step 8

    Heat 2 tbsp butter in a 10-inch skillet over medium-high heat until shimmering, about 90 seconds.

  9. Step 9

    Slide the stretched roti into the hot skillet. Fry 2 minutes until the bottom is golden and crispy.

  10. Step 10

    Flip and fry the other side 1–2 minutes until light golden. Transfer to a plate; keep warm.

  11. Step 11

    Repeat with the remaining dough, butter, and skillet.

  12. Step 12

    Tear or fold the roti into triangles or quarters. Serve hot with curry dip on the side.

Tools you’ll need

  • mixing bowl
  • damp cloth
  • 10-inch skillet (non-stick or cast iron preferred)
  • small skillet
  • spoon or silicone spatula
  • oil or ghee for the work surface

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.