Custrd is out on the App Store — Download it free →
Back to recipes

Meat Pie with Lattice Top

A hearty, homey meat pie with a golden lattice crust. The savory filling is simple and satisfying, perfect for a weeknight dinner.

Total time
45 min
Servings
6
Calories
480
Protein
22g
Meat Pie with Lattice Top
comfortingAmericanbeefflakyheartyweeknightpiedinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Roll out one pie crust and fit it into a 9-inch pie dish, trimming any overhang.

  2. Step 2

    In a skillet over medium-high heat, cook the 1 lb ground beef and 1 diced onion until the beef is browned and the onion is soft, about 8 minutes. Drain excess fat.

  3. Step 3

    Stir in the 1 cup frozen mixed vegetables and 1 cup beef gravy. Simmer for 5 minutes until thickened. Season with salt and pepper.

  4. Step 4

    Pour the filling into the pie crust. Roll out the second crust and cut into 1-inch strips. Arrange strips in a lattice pattern over the filling, pressing edges to seal.

  5. Step 5

    Beat the 1 egg with 1 tablespoon water and brush over the lattice. Bake until the crust is golden and the filling is bubbly, 25-30 minutes. Let rest 5 minutes before serving.

  6. Step 6

    Slice and serve warm.

Tools you’ll need

  • 9-inch pie dish
  • skillet
  • rolling pin
  • pastry brush
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.