Custrd is out on the App Store — Download it free →
Back to recipes

Savory Pie

A golden, flaky crust filled with savory meat, briny olives, and melted cheese. Perfect for a quick weeknight dinner or a casual gathering.

Total time
45 min
Servings
4
Calories
420
Protein
18g
Savory Pie
comfortingAmericanbeefflakycheesyweeknightpiedinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Press the 1 pie crust into a 9 inch pie dish, crimping the edges.

  2. Step 2

    In a skillet over medium heat, cook the 0.5 lb ground beef until browned, about 5-7 minutes. Drain excess fat.

  3. Step 3

    In a bowl, mix the cooked beef, 0.5 cup olives, 1 cup mozzarella, 1 egg, 0.5 tsp salt, and 0.25 tsp pepper until combined.

  4. Step 4

    Pour the filling into the crust and spread evenly.

  5. Step 5

    Bake for 25-30 minutes, until the crust is golden and the filling is set and slightly puffed.

  6. Step 6

    Let cool for 5 minutes before slicing and serving.

Tools you’ll need

  • 9 inch pie dish
  • skillet
  • mixing bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.