Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mediterranean Falafel Bowl

Crispy homemade falafel served over fluffy hummus with fresh vegetables, creamy tahini sauce, and tangy yogurt. A protein-packed vegetarian bowl that tastes like the Mediterranean.

Total time
45 min
Servings
2
Calories
520
Protein
18g
Mediterranean Falafel Bowl
freshwholesomemediterraneanvegetarianchickpeascrispycreamyfluffy

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place the drained chickpeas, onion, garlic, and parsley in a food processor and pulse until the mixture looks like coarse wet sand with no large chunks remaining, about 15 pulses.

  2. Step 2

    Sprinkle the flour and cumin over the chickpea mixture and pulse 5 more times until just combined, so the mixture holds together when squeezed but is not smooth.

  3. Step 3

    Scoop the mixture into 12 equal balls, each about the size of a golf ball, and place them on a plate.

  4. Step 4

    Pour 1.5 inches of neutral oil into a medium saucepan and heat over medium-high heat until a falafel ball immediately sizzles and floats to the surface when you carefully drop it in, about 3–4 minutes.

  5. Step 5

    Carefully place 6 falafel balls into the oil and fry for 2–3 minutes, stirring gently with a slotted spoon, until they are deep golden brown on all sides.

  6. Step 6

    Use the slotted spoon to transfer the cooked falafel to a paper-towel-lined plate.

  7. Step 7

    Repeat steps 5–6 with the remaining 6 falafel balls, letting the oil return to temperature between batches, about 2–3 minutes.

  8. Step 8

    Whisk together the tahini, Greek yogurt, and 3 tablespoons of water until the mixture is smooth and pourable, like thick pancake batter.

  9. Step 9

    Stir in the lemon juice and a pinch of salt, then taste and adjust salt or lemon juice to your preference.

  10. Step 10

    Spread half of the tahini sauce onto each of two serving bowls in a thin, even layer covering the bottom.

  11. Step 11

    Arrange 6 warm falafel balls in a circle on top of the sauce in each bowl.

Tools you’ll need

  • food processor
  • medium saucepan
  • instant-read or candy thermometer (optional, for oil temperature)
  • slotted spoon
  • paper towels
  • whisk
  • two serving bowls
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.