Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mediterranean Roasted Chicken Thighs

Bone-in chicken thighs roasted with olives, cherry tomatoes, and lemon until golden and juicy. Sheet-pan simplicity with bold Mediterranean flavors, ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
412
Protein
38g
Mediterranean Roasted Chicken Thighs
simplefreshmediterraneanchickencrispyjuicytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 8–10 minutes.

  2. Step 2

    Pat the chicken thighs dry with paper towels by pressing gently all over the skin and underside until no visible moisture remains.

  3. Step 3

    Mince the garlic cloves until the pieces are smaller than a grain of rice — about the size of pencil-tip dots.

  4. Step 4

    Cut the lemon in half lengthwise from end to end, then slice each half crosswise into thin half-moon slices about 1/4 inch thick.

  5. Step 5

    Arrange the chicken thighs skin-side up on a sheet pan so they do not touch, leaving space around each thigh.

  6. Step 6

    Scatter the cherry tomatoes, olives, lemon slices, and minced garlic around the chicken in the empty spaces on the pan.

  7. Step 7

    Drizzle 3 tablespoons of olive oil evenly over the chicken thighs and vegetables, then sprinkle salt and pepper over everything.

  8. Step 8

    Slide the sheet pan into the hot oven and roast until the chicken skin is the color of warm honey with dark brown edges, about 18–20 minutes.

  9. Step 9

    Remove the sheet pan from the oven using oven mitts and transfer the chicken and vegetables to a serving plate.

Tools you’ll need

  • oven
  • sheet pan (18 × 13 inches or larger)
  • paper towels
  • knife
  • cutting board
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.