Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Melty Pepper Jack Grilled Cheese

Crispy buttered bread with melted pepper jack cheese—sharp, slightly spicy, and ridiculously quick. Serve with a side salad to round it out.

Total time
10 min
Servings
1
Calories
380
Protein
14g
Melty Pepper Jack Grilled Cheese
comfortquickamericanvegetariancrispymeltyweeknightlunch

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Butter one side of each bread slice generously.

  2. Step 2

    Heat a skillet over medium heat. Once hot, lay one slice butter-side down.

  3. Step 3

    Layer pepper jack slices on top, then place the second bread slice butter-side up.

  4. Step 4

    Cook until the bottom is golden brown and crispy, about 3 minutes.

  5. Step 5

    Flip carefully and cook the other side until golden and the cheese is fully melted, 2–3 minutes.

  6. Step 6

    Slide onto a plate. Serve hot with the side salad.

Tools you’ll need

  • 8-inch or 10-inch nonstick or cast iron skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.