Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pepper Jack Grilled Cheese

Melty pepper jack cheese between buttered bread, toasted until golden and crispy. Serve with fries, pickled jalapeños, and a side salad for a classic diner lunch.

Total time
10 min
Servings
2
Calories
385
Protein
14g
Pepper Jack Grilled Cheese
comfortcasualamericanvegetariancrispymeltyweeknightlunch

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Butter one side of each bread slice generously, using about 1/2 tbsp per slice.

  2. Step 2

    Heat a skillet over medium heat until a water droplet sizzles on contact, ~1 minute.

  3. Step 3

    Place one slice butter-side down in the skillet, top with 2 cheese slices, then the second slice butter-side up.

  4. Step 4

    Toast 2–3 minutes until the bottom is golden brown and crispy.

  5. Step 5

    Flip and toast the other side 1–2 minutes until golden and cheese melts completely.

  6. Step 6

    Slice diagonally and serve immediately with fries, pickled jalapeños, and salad.

Tools you’ll need

  • 8-inch skillet
  • butter knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.