Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mochi Donuts with Matcha Glaze

Chewy, pillow-soft mochi donuts with a crispy exterior and vibrant matcha glaze. Baked, not fried, and ready in under 45 minutes with minimal equipment.

Total time
40 min
Servings
8
Calories
210
Protein
3g
Mochi Donuts with Matcha Glaze
indulgentelegantjapanesevegetarianchewycrispyfluffyDessert

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 350°F. Lightly grease a donut pan with cooking spray.

  2. Step 2

    Whisk flour, mochiko, sugar, and baking powder together in a medium bowl.

  3. Step 3

    In a separate bowl, whisk egg, milk, and vanilla until fully combined.

  4. Step 4

    Pour wet ingredients into dry ingredients. Stir until a thick, sticky batter forms—do not overmix.

  5. Step 5

    Transfer batter to a piping bag. Pipe into donut pan cavities until 3/4 full.

  6. Step 6

    Bake for 12–14 minutes until a toothpick inserted into a donut comes out clean.

  7. Step 7

    Cool in pan for 5 minutes, then turn out onto a wire rack to cool completely.

  8. Step 8

    Sift matcha powder and powdered sugar together in a small bowl until no lumps remain.

  9. Step 9

    Add 2–3 tablespoons water and whisk until glaze is smooth and pourable.

  10. Step 10

    Dip the top of each cooled donut into glaze, twisting gently to coat evenly.

  11. Step 11

    Set on parchment and let glaze set for 10 minutes before serving.

Tools you’ll need

  • donut pan (6- or 8-cavity)
  • medium mixing bowl
  • small mixing bowl
  • whisk
  • piping bag
  • wire rack
  • toothpick

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.