Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mushroom Hummus

Creamy tahini-chickpea base topped with sautéed mushrooms and garlic. A Lebanese-inspired dip that's rich, earthy, and ready in 10 minutes.

Total time
10 min
Servings
6
Calories
185
Protein
7g
Mushroom Hummus
casuallebanesevegetarianveganchickpeascreamysmoothAppetizer

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine chickpeas, tahini, 2 tbsp lemon juice, 2 tbsp water, and salt in a food processor.

  2. Step 2

    Blend until completely smooth and creamy, ~2 minutes. Add more water if too thick.

  3. Step 3

    Heat 2 tbsp olive oil in a skillet over medium-high heat until shimmering.

  4. Step 4

    Add mushrooms and garlic. Cook, stirring occasionally, until golden brown, ~5 minutes.

  5. Step 5

    Stir in remaining lemon juice and season with salt and pepper to taste.

  6. Step 6

    Spread hummus on a serving plate or bowl. Top with warm mushroom mixture.

  7. Step 7

    Drizzle with extra olive oil and serve warm or at room temperature.

Tools you’ll need

  • food processor
  • 12-inch skillet
  • measuring spoons
  • cutting board
  • chef's knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.