Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Nasi Lemak Rendang with Beef

Creamy coconut rice paired with rich, slow-cooked beef rendang infused with aromatics and spices. A complete Malaysian dinner that tastes restaurant-quality but comes together in one kitchen.

Total time
55 min
Servings
4
Calories
520
Protein
38g
Nasi Lemak Rendang with Beef
comfortindulgentmalaysianbeeftendercreamyweeknightdinner

Ingredients

11 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a heavy pot over medium. Add shallots, garlic, chili, and ginger; cook until fragrant, ~2 minutes.

  2. Step 2

    Add lemongrass and turmeric; stir constantly for 30 seconds until the mixture is deep golden and aromatic.

  3. Step 3

    Add beef chunks and stir until browned on all sides, breaking apart any lumps, ~5 minutes.

  4. Step 4

    Pour in coconut milk, scrape up any browned bits from the bottom, and bring to a simmer.

  5. Step 5

    Lower heat and simmer uncovered, stirring occasionally, until beef is tender and sauce clings to meat, ~30 minutes.

  6. Step 6

    While beef cooks, rinse rice under cold water until water runs clear; drain well.

  7. Step 7

    In a separate pot, combine rice, 1 cup coconut milk, and 1 cup water. Bring to a boil, then cover and reduce heat to low.

  8. Step 8

    Cook rice covered for 15 minutes, then check if liquid is absorbed. If not, cover and cook 2 more minutes. Season with salt.

  9. Step 9

    Divide rice among bowls and top with a generous spoonful of beef rendang and sauce. Serve hot.

Tools you’ll need

  • Heavy-bottomed pot or Dutch oven (at least 4-quart)
  • Medium pot with tight-fitting lid
  • Wooden spoon
  • Cutting board and chef's knife
  • Microplane or box grater for ginger
  • Measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.