Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min No-Bake Lemon Curd Tart

Glossy lemon curd in a buttery graham cracker crust, topped with torched meringue. Ready in 15 minutes — no oven required, just a kitchen torch.

Total time
15 min
Servings
6
Calories
285
Protein
3g
15-Min No-Bake Lemon Curd Tart
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix graham cracker crumbs with melted butter until resembles wet sand.

  2. Step 2

    Press firmly into a 9-inch tart pan or pie dish, creating an even layer.

  3. Step 3

    Spread lemon curd in an even layer across the crust.

  4. Step 4

    Whip egg whites with cream of tartar until soft peaks form, about 2 minutes.

  5. Step 5

    Add sugar 1 tbsp at a time while whisking until stiff, glossy peaks form.

  6. Step 6

    Dollop meringue onto lemon curd, spreading to edges. Torch the peaks until golden brown.

Tools you’ll need

  • 9-inch tart pan or pie dish
  • mixing bowl
  • whisk or electric mixer
  • kitchen torch
  • spatula or back of spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.