Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Beef Liver with Crispy Onions

Thin-sliced beef liver seared until just cooked through, layered with caramelized onions and a bright splash of balsamic. Ready in 15 minutes—restaurant-quality, weeknight-easy.

Total time
15 min
Servings
2
Calories
320
Protein
28g
Pan-Seared Beef Liver with Crispy Onions
elegantquickitalianbeeftendercrispyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add onion rings and cook, stirring occasionally, until golden and caramelized, 6–8 minutes. Season lightly with salt and pepper. Transfer to a plate.

  3. Step 3

    Pat liver dry with paper towels. Season both sides generously with salt and black pepper.

  4. Step 4

    Add remaining 2 tbsp oil to the skillet. Once smoking, lay liver slices flat and sear without moving, 90 seconds per side. Liver should be pink inside.

  5. Step 5

    Return onions to the skillet and drizzle everything with balsamic vinegar. Toss gently for 30 seconds until glossy.

  6. Step 6

    Plate immediately and scatter fresh thyme or parsley on top. Serve hot.

Tools you’ll need

  • 12-inch skillet (cast iron or stainless steel)
  • paper towels
  • tongs or spatula
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.