Custrd is out on the App Store — Download it free →
Back to recipes

Pan-Seared Fish Fillet with Carrot Puree and Asparagus

A quick and elegant weeknight dinner featuring a crispy-skinned fish fillet over a silky carrot puree, with tender asparagus and a simple pan sauce.

Total time
35 min
Servings
2
Calories
450
Protein
35g
Pan-Seared Fish Fillet with Carrot Puree and Asparagus
elegantcomfortingAmericangluten-freefishcrispycreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel and chop the 3 carrots into 1 inch chunks. Place in a small pot, cover with water, and boil until very tender, about 15 minutes.

  2. Step 2

    Drain the carrots and transfer to a blender. Add the 0.25 cup heavy cream, 1 tbsp butter, and a pinch of salt. Blend until completely smooth, about 1 minute. Set aside.

  3. Step 3

    Trim the woody ends from the 1 bunch asparagus. Heat 1 tbsp olive oil in a large skillet over medium-high. Add the asparagus and cook, turning occasionally, until bright green and crisp-tender, about 5 minutes. Season with salt and pepper, then remove to a plate.

  4. Step 4

    Pat the 2 fish fillets dry and season both sides with the remaining salt and pepper. Add the remaining 1 tbsp olive oil to the same skillet over medium-high. Place the fillets skin-side down and cook without moving until the skin is golden and crispy, about 4 minutes.

  5. Step 5

    Flip the fillets and cook until the flesh is opaque and flakes easily, about 2 more minutes. Remove the fish to a plate.

  6. Step 6

    Reduce the heat to low. Add the remaining 1 tbsp butter and 2 tbsp water to the skillet, scraping up any browned bits. Stir until the butter melts into a light sauce, about 1 minute.

  7. Step 7

    Spoon the carrot puree onto two plates. Top with the fish, arrange the asparagus alongside, and drizzle with the pan sauce.

Tools you’ll need

  • small pot
  • blender
  • large skillet
  • spatula
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.