Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Pancit Bihon

Stir-fried rice noodles with shrimp, chicken, and veggies in a light soy-garlic glaze. A Filipino weeknight classic that's crispy, savory, and ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
28g
20-Min Pancit Bihon
casualsatisfyingfilipinoshrimpchickentendercrispyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Soak rice noodles in hot water for 5 minutes until softened, then drain well.

  2. Step 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Add shrimp and cook, stirring, until pink, about 3 minutes. Push to the side.

  4. Step 4

    Add garlic to the cleared space, stir for 30 seconds until fragrant.

  5. Step 5

    Toss in carrots and cabbage, stir-fry 2 minutes until vegetables soften slightly.

  6. Step 6

    Add noodles, shredded chicken, and soy sauce. Toss everything for 1 minute until heated through and coated.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.