Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pastel de Camarão

Crispy Brazilian shrimp pastels with a simple filling and golden exterior. Served warm with lime wedges, these hand-held golden pockets are a beloved street food that come together in under 30 minutes.

Total time
28 min
Servings
4
Calories
385
Protein
18g
Pastel de Camarão
casualindulgentbrazilianshrimpcrispytenderweeknightparty

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine 2 cups flour, 0.75 cup warm water, and 0.5 teaspoon salt in a large bowl and stir with a wooden spoon until a smooth dough forms, about 2 minutes.

  2. Step 2

    Chop 1 pound shrimp into 1/4-inch pieces, about the size of peas, using a sharp chef's knife on a cutting board.

  3. Step 3

    Chop the 2 green onions crosswise into thin slices, about the thickness of a pencil, keeping white and green parts separate.

  4. Step 4

    Mix the chopped shrimp and green onion pieces together in a small bowl with a pinch of salt and black pepper until evenly combined.

  5. Step 5

    Dust a work surface lightly with flour, then divide the dough into 8 equal balls by pinching off chunks and rolling each between your palms until round and smooth.

  6. Step 6

    Place one dough ball on the floured surface, then use a rolling pin to flatten it into a thin circle about 4 inches across and the thickness of a credit card.

  7. Step 7

    Place 1 tablespoon of the shrimp mixture in the center of the circle, slightly below the middle, leaving a 0.5-inch border of empty dough all around.

  8. Step 8

    Fold the top half of the dough circle down over the filling, then use the tines of a fork to press and seal the edges together, creating a tight half-moon shape.

  9. Step 9

    Repeat steps 6–8 with the remaining 7 dough balls and shrimp filling until all pastels are assembled and sealed.

  10. Step 10

    Pour 2 quarts vegetable oil into a heavy-bottomed pot and heat over medium-high heat until the oil shimmers and a wooden spoon handle inserted into it produces tiny bubbles, about 5 minutes.

  11. Step 11

    Carefully place 2 pastels into the hot oil and fry until the surface turns golden brown, the color of honey, about 2 minutes.

  12. Step 12

    Flip the pastels gently with a slotted spoon and fry the second side until it also turns golden brown, about 2 more minutes.

  13. Step 13

    Use the slotted spoon to scoop the pastels onto a clean paper towel-lined plate to drain excess oil.

  14. Step 14

    Repeat steps 11–13 with the remaining 6 pastels, working in batches of 2 to avoid crowding the pot.

  15. Step 15

    Serve the pastels warm as soon as all are fried, with lime wedges on the side for squeezing.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • small bowl
  • sharp chef's knife
  • cutting board
  • rolling pin
  • fork
  • heavy-bottomed pot (3-quart or larger)
  • wooden spoon or chopstick for testing oil temperature
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.