Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pastel de Feira — Brazilian Fried Pastry

Golden, crispy-edged fried pastry pockets stuffed with a tangy cheese-and-green filling. Brazilian street food that's ready in 20 minutes and absolutely viral-worthy.

Total time
20 min
Servings
4
Calories
520
Protein
12g
Crispy Pastel de Feira — Brazilian Fried Pastry
casualindulgentbrazilianvegetariancheesecrispyflakysnack

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, water, and a pinch of salt until a soft dough forms. Knead briefly until smooth, about 2 minutes.

  2. Step 2

    Divide dough into 8 balls. Roll each into a thin 4-inch circle on a floured surface.

  3. Step 3

    Toss mozzarella with green onion, salt, and black pepper. Spoon 2 tbsp filling onto one half of each circle.

  4. Step 4

    Fold dough in half to form a half-moon. Press edges firmly with a fork to seal.

  5. Step 5

    Heat oil in a deep skillet to 350°F. Fry pastels 90 seconds per side until deep golden and edges curl.

  6. Step 6

    Drain on paper towels. Serve hot with lime wedges for squeezing.

Tools you’ll need

  • mixing bowl
  • rolling pin
  • fork
  • deep skillet or heavy pot
  • deep-fry or instant-read thermometer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.