Custrd is out on the App Store — Download it free →
Back to recipes

Pastitsio

A quick, comforting Greek-style baked pasta with a rich meat sauce, creamy cheese, and a golden breadcrumb topping. This simplified version brings all the flavor of the classic in under an hour.

Total time
45 min
Servings
4
Calories
650
Protein
35g
Pastitsio
comfortingGreekbeefcreamycrispyweeknightcasseroledinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Cook the 8 oz pasta in salted boiling water until just shy of al dente, about 7 minutes; drain and set aside.

  2. Step 2

    In a large skillet over medium-high, cook the 1 lb ground beef and 1 diced onion until beef is browned and onion is soft, about 8 minutes. Stir in the 15 oz tomato sauce and simmer until thickened, about 5 minutes.

  3. Step 3

    Combine the cooked pasta with the meat sauce and 1/2 cup of the mozzarella. Transfer to a baking dish and top with the remaining 1/2 cup mozzarella and the 1/2 cup breadcrumbs.

  4. Step 4

    Bake until bubbly and golden on top, about 20 minutes. Let stand 5 minutes before serving.

Tools you’ll need

  • Large pot
  • Large skillet
  • Baking dish

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.