Custrd is out on the App Store — Download it free →
Back to recipes

Tacos with Cheese Sauce

Quick and satisfying tacos with seasoned ground beef, a creamy cheese sauce, and fresh toppings. Perfect for a weeknight dinner.

Total time
20 min
Servings
4
Calories
550
Protein
30g
Tacos with Cheese Sauce
comfortingMexicanbeefcreamycrispyweeknightmaindinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a skillet over medium-high heat, cook the 1 lb ground beef, breaking it up, until browned and no longer pink, about 8 minutes. Drain excess fat.

  2. Step 2

    Stir in the 1 oz taco seasoning and 1/4 cup water. Simmer until thickened, about 2 minutes.

  3. Step 3

    In a small saucepan over medium heat, combine the 2 cups shredded cheddar cheese and 1/2 cup milk. Stir constantly until melted and smooth, about 3 minutes.

  4. Step 4

    Warm the 8 tortillas in a dry skillet or microwave. Fill each with the beef mixture, drizzle with cheese sauce, and top with the 1 cup diced tomatoes and chopped cilantro if desired.

  5. Step 5

    Serve immediately.

Tools you’ll need

  • large skillet
  • small saucepan
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.