Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pear Frangipane Tart

A classic French almond cream tart with caramelized pears on a buttery pastry base. Elegant enough for dinner guests, simple enough for a weeknight dessert.

Total time
50 min
Servings
8
Calories
342
Protein
6g
Pear Frangipane Tart
elegantindulgentfrenchvegetarianvegetariancreamyflakytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt. Cut 6 tbsp cold butter into pea-sized pieces and rub into flour until breadcrumb texture forms.

  2. Step 2

    Add 3 tbsp ice water a little at a time, tossing until the dough just comes together. Wrap and chill 15 minutes.

  3. Step 3

    Preheat oven to 375°F. Roll dough into a 10-inch circle and press into a 9-inch tart pan with removable bottom.

  4. Step 4

    Beat remaining 4 tbsp softened butter with sugar until pale, about 2 minutes. Fold in almond flour and egg until smooth.

  5. Step 5

    Spread frangipane evenly over dough base. Peel, halve, and core pears; arrange cut-side down in a spiral on top.

  6. Step 6

    Bake until pastry is golden and frangipane springs back when lightly touched, 30–35 minutes.

  7. Step 7

    Cool in pan 10 minutes, then transfer to a wire rack. Serve at room temperature or slightly warm.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • rolling pin
  • mixing bowl
  • electric mixer or whisk
  • rubber spatula
  • chef's knife
  • wire rack
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.