CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pesto Mozzarella & Zucchini Sandwich

Grilled zucchini with melted mozzarella and pesto on toasted bread — charred, cheesy, and ready in 15 minutes. Serve with fries and ketchup for the full plate.

Total time
15 min
Servings
2
Calories
385
Protein
14g
Crispy Pesto Mozzarella & Zucchini Sandwich
casualsimpleamericanvegetariancrispymeltytenderweeknight

Ingredients

  • 1 large zucchini
  • 4 slices bread (sandwich or ciabatta)
  • 4 oz mozzarella cheese
  • 3 tbsp pesto

Instructions

  1. 1

    Slice zucchini lengthwise into 1/4-inch planks, then pat dry with paper towels.

  2. 2

    Heat oil in a large skillet over medium-high until shimmering, then sear zucchini 2–3 minutes per side until golden and tender.

  3. 3

    Spread pesto on two bread slices, then layer zucchini and mozzarella on top.

  4. 4

    Top with the remaining bread slices, then wipe the skillet clean and add a touch more oil.

  5. 5

    Toast sandwiches over medium heat 2–3 minutes per side until bread is golden and cheese melts.

  6. 6

    Slice in half and serve hot with fries, ketchup, and green chutney on the side.

Tools you’ll need

  • cutting board
  • sharp knife
  • paper towels
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.