Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pesto Mozzarella & Zucchini Sandwich

Grilled zucchini with melted mozzarella and pesto on toasted bread — charred, cheesy, and ready in 15 minutes. Serve with fries and ketchup for the full plate.

Total time
15 min
Servings
2
Calories
385
Protein
14g
Crispy Pesto Mozzarella & Zucchini Sandwich
casualsimpleamericanvegetariancrispymeltytenderweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice zucchini lengthwise into 1/4-inch planks, then pat dry with paper towels.

  2. Step 2

    Heat oil in a large skillet over medium-high until shimmering, then sear zucchini 2–3 minutes per side until golden and tender.

  3. Step 3

    Spread pesto on two bread slices, then layer zucchini and mozzarella on top.

  4. Step 4

    Top with the remaining bread slices, then wipe the skillet clean and add a touch more oil.

  5. Step 5

    Toast sandwiches over medium heat 2–3 minutes per side until bread is golden and cheese melts.

  6. Step 6

    Slice in half and serve hot with fries, ketchup, and green chutney on the side.

Tools you’ll need

  • cutting board
  • sharp knife
  • paper towels
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.