Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Perfect Cheese Omelet

A simple two-fold omelet with melted cheese, ready in under 10 minutes. Fluffy eggs, a handful of cheese, and butter are all you need.

Total time
8 min
Servings
1
Calories
285
Protein
17g
Perfect Cheese Omelet
quicksimpleamericanvegetarianeggsfluffymeltyweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Crack eggs into a bowl, add a pinch of salt and pepper, and whisk until no white streaks remain.

  2. Step 2

    Heat butter in an 8-inch nonstick skillet over medium until it foams and smells nutty.

  3. Step 3

    Pour in eggs and let sit 30 seconds, then drag edges to center with a spatula, tilting skillet so raw egg fills gaps.

  4. Step 4

    When top is nearly set but still slightly wet, scatter cheese over one half.

  5. Step 5

    Fold omelet in half and slide onto a plate.

Tools you’ll need

  • 8-inch nonstick skillet
  • bowl
  • whisk
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.