Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pesto Mozzarella Grilled Cheese

A classic grilled cheese elevated with bright basil pesto and creamy fresh mozzarella. Toasted golden on the outside, melted and aromatic on the inside.

Total time
10 min
Servings
2
Calories
380
Protein
14g
Pesto Mozzarella Grilled Cheese
comfortsimpleitalianvegetariancrispymeltyweeknightsandwich

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Butter one side of each bread slice evenly with 0.5 tbsp butter.

  2. Step 2

    Heat a skillet over medium until water droplets sizzle on contact, ~90 seconds.

  3. Step 3

    Place two slices butter-side down in the skillet. Cook until golden brown, ~2 minutes.

  4. Step 4

    Spread 1.5 tbsp pesto on the toasted side of each slice in the pan.

  5. Step 5

    Layer mozzarella and tomato on one slice. Season with salt and pepper.

  6. Step 6

    Top with the other slice, pesto-side down. Gently press together.

  7. Step 7

    Flip and cook the second side until golden and cheese oozes at the edges, ~2 minutes.

  8. Step 8

    Transfer to a plate and serve hot. Repeat with remaining ingredients for second sandwich.

Tools you’ll need

  • skillet (12-inch preferred)
  • butter knife or small spreader
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.