Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Caprese Grilled Cheese

Buttery grilled bread wrapped around melted fresh mozzarella, tomato, and basil—the classic Italian salad as a warm, crispy sandwich. Ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
320
Protein
12g
Caprese Grilled Cheese
simplecomfortitalianvegetariancrispymeltyweeknightlunch

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the tomato into 4 thin rounds, then gently pat dry with a paper towel.

  2. Step 2

    Layer 2 oz mozzarella, 2 tomato slices, and 3 basil leaves between two bread slices.

  3. Step 3

    Heat a skillet over medium until a drop of water sizzles, then add butter and let it foam.

  4. Step 4

    Slide the sandwich into the skillet and cook until the bottom is golden brown, 2–3 minutes.

  5. Step 5

    Flip and cook the other side until golden and the cheese melts, another 2–3 minutes.

  6. Step 6

    Slice in half diagonally and serve immediately while the cheese is still warm.

Tools you’ll need

  • cutting board
  • chef's knife
  • paper towels
  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.