CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Caprese Grilled Cheese

Buttery grilled bread wrapped around melted fresh mozzarella, tomato, and basil—the classic Italian salad as a warm, crispy sandwich. Ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
320
Protein
12g
Caprese Grilled Cheese
simplecomfortitalianvegetariancrispymeltyweeknightlunch

Ingredients

  • 4 slices bread
  • 4 oz fresh mozzarella
  • 1 medium tomato
  • 6 leaves fresh basil

Instructions

  1. 1

    Slice the tomato into 4 thin rounds, then gently pat dry with a paper towel.

  2. 2

    Layer 2 oz mozzarella, 2 tomato slices, and 3 basil leaves between two bread slices.

  3. 3

    Heat a skillet over medium until a drop of water sizzles, then add butter and let it foam.

  4. 4

    Slide the sandwich into the skillet and cook until the bottom is golden brown, 2–3 minutes.

  5. 5

    Flip and cook the other side until golden and the cheese melts, another 2–3 minutes.

  6. 6

    Slice in half diagonally and serve immediately while the cheese is still warm.

Tools you’ll need

  • cutting board
  • chef's knife
  • paper towels
  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.