Custrd is out on the App Store — Download it free →
Back to recipes

Pesto Pasta with Blistered Tomatoes and White Beans

A pantry-friendly weeknight pasta where blistered cherry tomatoes burst into a sweet sauce and creamy white beans add unexpected substance.

Total time
20 min
Servings
4
Calories
460
Protein
17g
Pesto Pasta with Blistered Tomatoes and White Beans
pastavegetarianitalianweeknightpantry

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of well-salted water to a boil and cook the pasta until al dente. Save a cup of pasta water before draining.

  2. Step 2

    While the pasta cooks, heat the olive oil in a wide skillet over medium-high. Add the smashed garlic and let it sizzle for about 30 seconds.

  3. Step 3

    Add the cherry tomatoes and a pinch of salt. Cook, shaking the pan occasionally, until most of them have burst and released their juice, about 5 minutes.

  4. Step 4

    Stir in the white beans and warm them through, about 2 minutes.

  5. Step 5

    Add the drained pasta, the pesto, and a few splashes of pasta water. Toss everything together until you have a glossy sauce that clings to the noodles. Finish with parmesan, flaky salt, and a few cracks of pepper.

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.