Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Phyllo Cups with Herbed Ricotta

Delicate, golden phyllo cups filled with creamy ricotta, fresh herbs, and roasted cherry tomatoes. A restaurant-quality appetizer or light dinner ready in 35 minutes.

Total time
35 min
Servings
4
Calories
285
Protein
12g
Crispy Phyllo Cups with Herbed Ricotta
elegantlightitalianvegetariancheesecrispycreamyweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Line a baking sheet with parchment paper.

  2. Step 2

    Stack phyllo sheets, brush each lightly with melted butter, then layer into 4 oven-safe ramekins or muffin tins.

  3. Step 3

    Bake phyllo cups until golden and crisp, 12–14 minutes. Remove and cool slightly.

  4. Step 4

    Toss cherry tomatoes with 1 tbsp melted butter, garlic, salt, and pepper. Roast on the baking sheet alongside cups for the last 10 minutes.

  5. Step 5

    Mix ricotta, parmesan, fresh herbs, lemon zest, and lemon juice in a bowl. Season with salt and pepper.

  6. Step 6

    Spoon ricotta filling into each phyllo cup, top with roasted tomatoes, and serve warm.

Tools you’ll need

  • baking sheet
  • parchment paper
  • pastry brush
  • 4 oven-safe ramekins or muffin tin
  • mixing bowl
  • microplane zester

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.