Custrd is out on the App Store — Download it free →
Back to recipes

Potato and Bacon Tartiflette

A hearty French-inspired skillet dish with tender potatoes, crispy bacon, and melted cheese. Perfect for a cozy weeknight dinner.

Total time
40 min
Servings
4
Calories
420
Protein
18g
Potato and Bacon Tartiflette
comfortingFrenchbaconcreamycrispyweeknightmaindinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Slice potatoes into 1/4-inch rounds. Toss with 1 tbsp olive oil, 0.5 tsp salt, and 0.25 tsp pepper.

  2. Step 2

    Cook 6 oz bacon in a 9-inch oven-safe skillet over medium heat until crispy, about 6-8 minutes. Remove bacon, leaving 1 tbsp drippings in skillet.

  3. Step 3

    Add 1 sliced onion to skillet and cook until soft and golden, about 5 minutes. Stir in potatoes and cook, stirring occasionally, until slightly browned, about 8 minutes.

  4. Step 4

    Crumble bacon over potatoes and stir to combine. Sprinkle 1 cup shredded Gruyère evenly over the top.

  5. Step 5

    Transfer skillet to oven and bake until cheese is melted and bubbly and potatoes are tender, about 15-20 minutes. Let rest 5 minutes before serving.

  6. Step 6

    Optional: sprinkle with fresh herbs like thyme or chives before serving if you have them.

Tools you’ll need

  • 9-inch oven-safe skillet
  • knife
  • cutting board
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.