Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Prasorizo

Tender leeks and arborio rice baked together in a creamy tomato sauce with fresh dill and feta—a classic Greek comfort dish that's naturally vegetarian and ready in under an hour.

Total time
50 min
Servings
4
Calories
385
Protein
11g
Prasorizo
comfortwholesomegreekvegetarianvegetariancreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Trim leeks and slice into 1-inch rounds, separating layers; rinse thoroughly.

  2. Step 2

    Heat olive oil in a 9x13-inch baking dish over medium heat, then sauté leeks until edges begin to soften, ~4 minutes.

  3. Step 3

    Stir in arborio rice and toast for 1 minute until it looks slightly translucent at the edges.

  4. Step 4

    Pour in crushed tomatoes and vegetable broth; stir well. Season with salt and pepper.

  5. Step 5

    Cover the baking dish with foil and transfer to the oven. Bake for 35–40 minutes until rice is tender and liquid absorbs.

  6. Step 6

    Remove from oven and stir in feta cheese and fresh dill. Adjust seasoning and serve hot.

Tools you’ll need

  • 9x13-inch baking dish
  • aluminum foil
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.