Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Puchka (Crispy Potato Pani Puri)

Hollow crispy shells filled with spiced potatoes, chickpeas, and tangy tamarind water. A beloved Indian street snack that's crunchy, refreshing, and bursting with flavor in every bite.

Total time
25 min
Servings
2
Calories
185
Protein
6g
Puchka (Crispy Potato Pani Puri)
casualfreshindianvegetarianchickpeascrispycrunchysnack

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut each boiled potato into 1/4-inch cubes—small enough to fit inside a puri shell. Place the cubes in a small bowl.

  2. Step 2

    Pour the tamarind paste into a measuring cup and add 1 cup of water; stir until the paste is completely dissolved and the liquid is dark brown and thin, about 30 seconds.

  3. Step 3

    Add the cumin powder, cayenne pepper, and chickpeas to the potato cubes; stir gently until everything is evenly coated.

  4. Step 4

    Hold one puri shell carefully in your hand and gently poke a hole in the top with your thumb, making an opening about the size of a fingertip.

  5. Step 5

    Spoon 1 heaping teaspoon of the potato-chickpea mixture into the opening of the puri shell, filling it so the mixture is just visible at the top.

  6. Step 6

    Set the filled puri on a serving plate, opening facing upward; repeat with remaining shells and filling until you have 12 filled puris.

  7. Step 7

    Place a small cup or bowl of tamarind water on the plate next to the puris; diners will pop each puri in their mouth, bite off the bottom, and sip the tamarind water through the hole.

Tools you’ll need

  • cutting board
  • paring knife
  • 2 small bowls
  • measuring cup
  • measuring spoons
  • spoon for stirring
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.