Custrd is out on the App Store — Download it free →
Back to recipes

Puri with Chickpea Curry and Chutneys

Crispy, puffed puri bread served with a spiced chickpea curry and tangy onion chutney. A quick, satisfying meal that's perfect for any time of day.

Total time
20 min
Servings
4
Calories
350
Protein
12g
Puri with Chickpea Curry and Chutneys
comfortingquickindianveganvegetarianchickpeacrispycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Drain and rinse the 2 cans of chickpeas. Finely chop the 1 onion and 1 tomato.

  2. Step 2

    Heat 1 tbsp oil in a pan over medium. Add the chopped onion and cook until soft, about 5 minutes.

  3. Step 3

    Add the chopped tomato and 2 tbsp chana masala spice. Cook until the tomato breaks down, about 3 minutes.

  4. Step 4

    Stir in the chickpeas and 1 cup water. Simmer until thickened, about 10 minutes. Squeeze in juice from half the lime.

  5. Step 5

    Warm the 8 puri in a dry skillet for 1 minute per side. Serve the curry with puri, remaining lime wedges, and chutney if desired.

Tools you’ll need

  • large skillet
  • pan
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.