CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Quick Asam Laksa with Shrimp

A vibrant, tangy Malaysian noodle soup built on a streamlined paste of tamarind, chili, and aromatics. Ready in 20 minutes with shrimp and fresh herbs.

Total time
20 min
Servings
2
Calories
340
Protein
22g
Quick Asam Laksa with Shrimp
freshlightmalaysianshrimptendersilkyweeknightsoup

Ingredients

  • 2 tablespoons tamarind paste
  • 1 tablespoon Thai red chili paste
  • 2 cloves garlic, minced
  • ½ pound shrimp, peeled and deveined
  • 6 ounces egg noodles or rice noodles, uncooked
  • 1 tablespoon fish sauce

Instructions

  1. 1

    Mince the garlic until the pieces are smaller than a grain of rice, about the size of pencil-tip dots.

  2. 2

    Fill a large pot with 4 cups of water and bring it to a boil over high heat, about 6 minutes.

  3. 3

    Pour the tamarind paste and red chili paste into a small bowl and stir them together until well combined, breaking up any lumps.

  4. 4

    Once the water boils, add the noodles to the pot and stir once with a wooden spoon to separate them.

  5. 5

    Cook the noodles, stirring once every 30 seconds, until they are tender but still firm to bite, about 6 minutes total.

  6. 6

    While noodles cook, heat 1 tablespoon of oil in a separate small skillet over medium heat until it shimmers, about 1 minute.

  7. 7

    Add the minced garlic to the hot oil and stir constantly for 15 seconds until it smells fragrant, then add the tamarind-chili mixture and stir for another 15 seconds.

  8. 8

    Pour the garlic-tamarind mixture into the noodle pot, add the shrimp and fish sauce, and stir gently.

  9. 9

    Simmer over medium heat, stirring once every 20 seconds, until the shrimp turn from gray to opaque pink throughout, about 3 minutes.

  10. 10

    Taste the broth and add salt and pepper as needed, stirring once to combine.

  11. 11

    Ladle the noodles, shrimp, and broth into two bowls, dividing evenly.

Tools you’ll need

  • large pot (4-quart)
  • small skillet (8-inch)
  • small bowl
  • wooden spoon
  • ladle
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.