Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Asam Laksa with Shrimp

A vibrant, tangy Malaysian noodle soup built on a streamlined paste of tamarind, chili, and aromatics. Ready in 20 minutes with shrimp and fresh herbs.

Total time
20 min
Servings
2
Calories
340
Protein
22g
Quick Asam Laksa with Shrimp
freshlightmalaysianshrimptendersilkyweeknightsoup

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mince the garlic until the pieces are smaller than a grain of rice, about the size of pencil-tip dots.

  2. Step 2

    Fill a large pot with 4 cups of water and bring it to a boil over high heat, about 6 minutes.

  3. Step 3

    Pour the tamarind paste and red chili paste into a small bowl and stir them together until well combined, breaking up any lumps.

  4. Step 4

    Once the water boils, add the noodles to the pot and stir once with a wooden spoon to separate them.

  5. Step 5

    Cook the noodles, stirring once every 30 seconds, until they are tender but still firm to bite, about 6 minutes total.

  6. Step 6

    While noodles cook, heat 1 tablespoon of oil in a separate small skillet over medium heat until it shimmers, about 1 minute.

  7. Step 7

    Add the minced garlic to the hot oil and stir constantly for 15 seconds until it smells fragrant, then add the tamarind-chili mixture and stir for another 15 seconds.

  8. Step 8

    Pour the garlic-tamarind mixture into the noodle pot, add the shrimp and fish sauce, and stir gently.

  9. Step 9

    Simmer over medium heat, stirring once every 20 seconds, until the shrimp turn from gray to opaque pink throughout, about 3 minutes.

  10. Step 10

    Taste the broth and add salt and pepper as needed, stirring once to combine.

  11. Step 11

    Ladle the noodles, shrimp, and broth into two bowls, dividing evenly.

Tools you’ll need

  • large pot (4-quart)
  • small skillet (8-inch)
  • small bowl
  • wooden spoon
  • ladle
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.