Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quinoa Buddha Bowl with Tahini Dressing

Protein-packed quinoa base topped with roasted chickpeas, crisp vegetables, and a creamy tahini dressing. Build it fresh in under 25 minutes.

Total time
25 min
Servings
2
Calories
480
Protein
14g
Quinoa Buddha Bowl with Tahini Dressing
wholesomefreshmediterraneanvegetarianveganchickpeasfluffycrunchy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse quinoa under cold water. Boil in salted water until fluffy and liquid absorbs, ~15 minutes.

  2. Step 2

    Cut sweet potato into 1/2-inch cubes. Pat chickpeas dry with a clean kitchen towel.

  3. Step 3

    Toss chickpeas with 1.5 tbsp olive oil, salt, and pepper. Spread on a sheet pan.

  4. Step 4

    Roast chickpeas at 425°F until crispy and golden, ~12 minutes, shaking halfway through.

  5. Step 5

    Heat 1.5 tbsp olive oil in a skillet over medium-high. Add sweet potato cubes.

  6. Step 6

    Cook sweet potato until edges soften and char, ~8 minutes, stirring occasionally.

  7. Step 7

    Whisk tahini with lemon juice and 2 tbsp water until pourable. Season with salt and pepper.

  8. Step 8

    Divide quinoa between bowls. Add sweet potato and chickpeas. Top with fresh spinach.

  9. Step 9

    Drizzle tahini dressing over the top. Serve immediately.

Tools you’ll need

  • small saucepan with lid
  • sheet pan
  • 12-inch skillet
  • 2 medium bowls
  • small whisk
  • kitchen towel

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.