Back to recipes
Ricotta Toast with Honey
Creamy ricotta spread on warm toast, drizzled with golden honey and a pinch of sea salt. Ready in under 5 minutes—the perfect snack or light breakfast.
- Total time
- 5 min
- Servings
- 2
- Calories
- 245
- Protein
- 9g
simplefreshvegetariancheesecreamycrispyweeknighttoast
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast bread until golden and crisp, ~2–3 minutes per side.
Step 2
Divide ricotta evenly between the two slices, spreading gently with a knife.
Step 3
Drizzle honey over each toast in a thin zigzag, then sprinkle with sea salt.
Step 4
Serve immediately while the toast is still warm.
Tools you’ll need
- toaster or toaster oven
- knife
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
