Custrd is out on the App Store — Download it free →
Back to recipes

Salmon Sushi Roll

A simple homemade sushi roll filled with fresh salmon, creamy cheese, and green onion, wrapped in nori and seasoned rice.

Total time
35 min
Servings
2
Calories
420
Protein
22g
Salmon Sushi Roll
satisfyingjapanesepescatarianfishchewycreamyweeknightsushi

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the 1 cup sushi rice in cold water until clear, then combine with 1.25 cups water in a pot. Bring to a boil, cover, reduce to low, and cook until water is absorbed, about 15 minutes.

  2. Step 2

    While rice cooks, mix 2 tbsp rice vinegar, 1 tsp sugar, and 0.5 tsp salt in a small bowl until dissolved. After rice is done, let it rest 5 minutes, then fold in the vinegar mixture and spread on a plate to cool.

  3. Step 3

    Slice the 4 oz salmon into thin strips about 1/2 inch wide. Cut the 2 tbsp cream cheese into similar-sized strips. Slice green onions into thin pieces if you have them.

  4. Step 4

    Place one nori sheet on a bamboo mat or clean surface, shiny side down. Wet your hands with water and spread half the rice evenly over the nori, leaving a 1-inch strip at the top edge.

  5. Step 5

    Arrange half the salmon and cream cheese strips in a line across the rice, about 1 inch from the bottom edge. Sprinkle with green onion if using.

  6. Step 6

    Lift the mat and roll the nori over the filling, tucking tightly. Continue rolling to the end, then press gently to seal. Repeat with the second sheet and remaining filling.

  7. Step 7

    Using a sharp wet knife, slice each roll into 6 pieces. Wipe the knife between cuts for clean edges. Serve with wasabi and soy sauce if desired.

Tools you’ll need

  • bamboo sushi mat
  • sharp knife
  • small bowl
  • pot with lid

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.