Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Sambal Squid Over Coconut Rice

Crispy pan-fried squid tossed in fiery sambal paired with buttery coconut rice. One skillet, 10 minutes, pure Malaysian comfort.

Total time
10 min
Servings
2
Calories
385
Protein
26g
10-Min Sambal Squid Over Coconut Rice
quickindulgentmalaysiansquidcrispytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering. Add shallots, cook for 1 minute until fragrant.

  2. Step 2

    Stir in sambal and coconut milk, cooking for 30 seconds until aromatic and glossy.

  3. Step 3

    Add squid rings and cook, stirring constantly, until opaque and just tender, about 3 minutes. Don't overcook.

  4. Step 4

    Squeeze lime juice into the pan, add lime zest, and toss gently until coated.

  5. Step 5

    Divide warm rice between bowls and top with sambal squid and all sauce.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • cutting board
  • knife
  • microplane (for lime zest)
  • bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.