Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sarawak Laksa

Rich coconut broth with laksa paste, egg noodles, shrimp, and chicken in one pot. Tangy, spicy, and deeply savory — Malaysia on a plate in 20 minutes.

Total time
20 min
Servings
2
Calories
485
Protein
38g
Sarawak Laksa
comfortboldmalaysianshrimpchickentenderchewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to boil. Add noodles, stir, and cook until al dente, ~5 minutes. Drain and set aside.

  2. Step 2

    In the same pot, heat 1 tbsp oil over medium heat. Stir in laksa paste until fragrant, about 60 seconds.

  3. Step 3

    Pour in coconut milk and stock. Bring to a simmer, stirring to blend the paste.

  4. Step 4

    Add shrimp and shredded chicken. Simmer until shrimp turn pink, about 4 minutes.

  5. Step 5

    Divide noodles between two bowls. Ladle broth, shrimp, and chicken over the top.

  6. Step 6

    Squeeze lime juice over each bowl. Top with bean sprouts and fresh cilantro or green onion. Serve hot.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander
  • two serving bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.