Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Seafood Mohinga

Burmese fish curry soup that comes together in one pot with shrimp, rice noodles, and a fragrant turmeric-garlic broth. Topped with crispy fried shallots and lime — pure TikTok comfort.

Total time
20 min
Servings
2
Calories
385
Protein
28g
20-Min Seafood Mohinga
comfortboldburmeseshrimptendersilkyweeknightcozy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring 4 cups water to a boil in a large pot over medium-high heat.

  2. Step 2

    Add turmeric, chili flakes, minced garlic, and fish sauce to the boiling water.

  3. Step 3

    Add rice noodles and cook for 3 minutes until just softened, stirring once.

  4. Step 4

    Add shrimp and simmer for 2 minutes, stirring gently, until pink and just cooked through.

  5. Step 5

    Squeeze lime juice into the pot and stir. Taste and add salt if needed.

  6. Step 6

    Ladle into bowls and top generously with crispy fried shallots. Serve immediately.

Tools you’ll need

  • large pot (4-5 quart capacity)
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.