Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Sesame Veggie Fried Rice

Crispy veggie fried rice with a soy-sesame glaze, ready in 10 minutes flat. Loads of color, zero fuss — the weeknight dinner that tastes better than takeout.

Total time
10 min
Servings
2
Calories
285
Protein
6g
10-Min Sesame Veggie Fried Rice
quicksatisfyingasianvegetarianvegancrispytenderweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, about 60 seconds.

  2. Step 2

    Add frozen vegetables and stir constantly until heated through and edges char slightly, 3 minutes.

  3. Step 3

    Add rice, breaking up clumps, then drizzle soy sauce and toss until every grain is coated, 2 minutes.

  4. Step 4

    Remove from heat and sprinkle sesame seeds over the top.

  5. Step 5

    Serve immediately in bowls.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.