CookSnap is in beta — Get it free on TestFlight →
Back to recipes

10-Min Sesame Veggie Fried Rice

Crispy veggie fried rice with a soy-sesame glaze, ready in 10 minutes flat. Loads of color, zero fuss — the weeknight dinner that tastes better than takeout.

Total time
10 min
Servings
2
Calories
285
Protein
6g
10-Min Sesame Veggie Fried Rice
quicksatisfyingasianvegetarianvegancrispytenderweeknight

Ingredients

  • 2 cups cooked rice (white or brown, cooled or day-old)
  • 1.5 cups frozen mixed vegetables
  • 2 tbsp soy sauce
  • 2 tbsp sesame seeds

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, about 60 seconds.

  2. 2

    Add frozen vegetables and stir constantly until heated through and edges char slightly, 3 minutes.

  3. 3

    Add rice, breaking up clumps, then drizzle soy sauce and toss until every grain is coated, 2 minutes.

  4. 4

    Remove from heat and sprinkle sesame seeds over the top.

  5. 5

    Serve immediately in bowls.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.