Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Loukaniko with Peppers

Greek pork sausages caramelized with bell peppers, onions, and a hit of oregano—crispy edges, tender insides, done in 20 minutes on one pan. Serve with crusty bread to soak up the pan juices.

Total time
20 min
Servings
2
Calories
380
Protein
24g
Sheet-Pan Loukaniko with Peppers
comfortcasualgreekporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Toss sausages, pepper, onion, garlic, oregano, olive oil, salt, and pepper on a sheet pan.

  2. Step 2

    Spread everything in a single layer. Roast for 15 minutes, shaking the pan halfway through, until sausages are golden and cooked through.

  3. Step 3

    Remove from oven. The sausage edges should look caramelized and crispy, juices pooled in the pan.

  4. Step 4

    Serve hot directly from the pan with crusty bread to catch the pan juices.

Tools you’ll need

  • 18-inch sheet pan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.