Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet Pan Sausage & Pierogi with Caramelized Cabbage

Smoked sausage, frozen pierogi, and shredded cabbage roast together on one pan with crispy, caramelized edges in under 25 minutes. Serve straight from the sheet pan for the ultimate no-fuss Polish-inspired weeknight dinner.

Total time
25 min
Servings
4
Calories
580
Protein
28g
Sheet Pan Sausage & Pierogi with Caramelized Cabbage
comfortcasualpolishporkcrispytenderweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice sausage into half-moons and spread across a large sheet pan with the shredded cabbage.

  2. Step 2

    Drizzle olive oil over everything, add 1 tsp salt and 1/2 tsp black pepper, then toss until evenly coated.

  3. Step 3

    Roast at 425°F for 12 minutes, then stir the pan and scatter frozen pierogi across the top.

  4. Step 4

    Roast for another 10–12 minutes until pierogi are golden and cabbage edges turn crispy and brown.

  5. Step 5

    Serve straight from the pan while hot.

Tools you’ll need

  • large sheet pan (18x13 inch)
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.