Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Ramazan Pidesi

Crispy, sesame-topped flatbread baked straight on a sheet pan—no dough-making required. Ready in 15 minutes with store-bought pizza dough and a brush of olive oil.

Total time
15 min
Servings
2
Calories
385
Protein
9g
Sheet-Pan Ramazan Pidesi
simplecomfortturkishvegetariancrispyflakyweeknightramadan

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 425°F. Place pizza dough on a sheet pan and press into an even 1/4-inch-thick rectangle.

  2. Step 2

    Brush dough generously with olive oil. Sprinkle minced garlic, sesame seeds, nigella seeds, and salt across the surface.

  3. Step 3

    Bake until edges are deep golden and puffed, about 10–12 minutes. The top should look crispy and fragrant.

  4. Step 4

    Remove from oven and let cool 2 minutes. Cut into pieces and serve warm.

Tools you’ll need

  • sheet pan
  • oven
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.