Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Shrimp Empanadas

Crispy, golden empanadas filled with garlicky shrimp, baked on a sheet pan in under 30 minutes. A weeknight shortcut using store-bought wrappers for restaurant-quality results.

Total time
25 min
Servings
2
Calories
285
Protein
16g
Sheet-Pan Shrimp Empanadas
quickcasualmexicanshrimpcrispytenderweeknightappetizer

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. Step 2

    Mince the garlic until the pieces are smaller than a grain of rice—about the size of pencil-tip dots—and set aside in a small bowl.

  3. Step 3

    Cut the lime in half lengthwise from tip to tip, then squeeze both halves into a separate small bowl until you have about 2 tablespoons of juice.

  4. Step 4

    Place the shrimp in the bowl with the lime juice, add the minced garlic, sprinkle with a pinch of salt and pepper, and stir until all shrimp are coated.

  5. Step 5

    Let the shrimp sit in the lime mixture for 5 minutes so the flavors start to blend into the meat.

  6. Step 6

    Place one empanada wrapper on your work surface and spoon 1 tablespoon of the shrimp filling (including a bit of the lime juice) slightly to one side of the center, leaving a 1/2-inch border all around.

  7. Step 7

    Fold the wrapper in half over the filling to make a half-moon shape, then press the curved edge firmly with your fingers or a fork to seal it completely so no shrimp escapes during baking.

  8. Step 8

    Repeat the filling and folding for the remaining 5 wrappers until all 6 empanadas are sealed and placed in a line on a baking sheet.

  9. Step 9

    Brush or drizzle 2 tablespoons of olive oil over all 6 empanadas, coating both the top and sides, so they will brown evenly in the oven.

  10. Step 10

    Slide the baking sheet into the preheated 400°F oven and bake for 12 to 15 minutes until the wrapper surface turns golden brown and feels crispy when you tap it gently with a spatula.

  11. Step 11

    Remove the baking sheet from the oven using an oven mitt on both hands and set it on a heat-safe surface to cool for 2 minutes before serving.

Tools you’ll need

  • oven
  • baking sheet
  • small bowls (2)
  • cutting board
  • chef's knife
  • fork or your fingers (for sealing)
  • pastry brush or small spoon (for oil)
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.