Custrd is out on the App Store — Download it free →
Back to recipes

Fried Shrimp with French Fries

Crispy golden shrimp and french fries, served with a squeeze of fresh lemon and a sprinkle of herbs. A quick and satisfying meal that's ready in about 20 minutes.

Total time
20 min
Servings
2
Calories
450
Protein
25g
Fried Shrimp with French Fries
comfort foodquickamericanpescatarianshrimpcrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook the 0.75 lb frozen french fries according to package directions, usually 15-20 minutes in a 425°F oven, until golden and crisp.

  2. Step 2

    While fries cook, pat the 0.5 lb shrimp dry and season with salt and pepper. Heat 2 tbsp olive oil in a large skillet over medium-high heat.

  3. Step 3

    Add the shrimp in a single layer and cook until pink and opaque, about 2 minutes per side. Add 2 minced garlic cloves and cook for 30 seconds until fragrant.

  4. Step 4

    Squeeze the juice of half a lemon over the shrimp and toss with 1 tbsp chopped parsley. Serve the shrimp alongside the fries with extra lemon wedges if desired.

  5. Step 5

    Enjoy immediately while hot and crispy.

Tools you’ll need

  • baking sheet
  • large skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.