Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Snoek Braai with Roasted Potatoes

South African grilled snoek (or sea bass) with crispy roasted potatoes, lemon, and chili — all on one sheet pan. High-heat, minimal fuss, maximum flavor.

Total time
25 min
Servings
2
Calories
385
Protein
32g
Sheet-Pan Snoek Braai with Roasted Potatoes
casualfreshsouth-africanfishcrispytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 450°F. Toss potatoes with 2 tbsp olive oil, salt, and pepper on a sheet pan.

  2. Step 2

    Roast potatoes for 12 minutes until they start to soften and edges brown.

  3. Step 3

    Pat fish dry. Brush both sides with remaining olive oil, season with salt and pepper.

  4. Step 4

    Push potatoes to the sides of the pan. Lay fish skin-side up in the center.

  5. Step 5

    Top fish with lemon slices and chili. Roast 8–10 minutes until skin is crispy and flesh flakes.

  6. Step 6

    Squeeze fresh lemon over the plate. Serve hot with potatoes and any pan juices.

Tools you’ll need

  • sheet pan
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.